PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D02326.1.p
Common NameEUGRSUZ_D02326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 124aa    MW: 14350.3 Da    PI: 10.591
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D02326.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.4e-334098159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                      ldDg++WrKYGqK vk+s++prsYYrC++  C+vkk+v+r +ed+++v++tYeg Hnh+
  Eucgr.D02326.1.p 40 LDDGFRWRKYGQKAVKNSTHPRSYYRCAHIACNVKKQVQRLSEDTSIVVTTYEGIHNHP 98
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-332799IPR003657WRKY domain
SuperFamilySSF1182903.92E-293299IPR003657WRKY domain
PROSITE profilePS5081128.44935100IPR003657WRKY domain
SMARTSM007742.2E-384099IPR003657WRKY domain
PfamPF031062.6E-264198IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MEEIRARRLE KRSKAAASSR ARKAASPRFE FQTRSEDDLL DDGFRWRKYG QKAVKNSTHP  60
RSYYRCAHIA CNVKKQVQRL SEDTSIVVTT YEGIHNHPSE KIMETLSPLL RQIQLLSRFS  120
PDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-263197874Probable WRKY transcription factor 4
2lex_A1e-263197874Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D02326.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053764.11e-87PREDICTED: probable WRKY transcription factor 75
SwissprotQ8GY113e-53WRK43_ARATH; Probable WRKY transcription factor 43
SwissprotQ8VWQ43e-52WRK56_ARATH; Probable WRKY transcription factor 56
SwissprotQ9FFS31e-52WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLA0A059CI983e-88A0A059CI98_EUCGR; Uncharacterized protein
STRINGGLYMA16G03480.21e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.12e-51WRKY DNA-binding protein 56